dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|341913654|ref|XP_003403667.1| (Homo sapiens )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: MAM and LDL-receptor class A domain-containing protein C10orf112 [Homo sapiens]
Sequence length 632
Sequence
MGLARAVSKLWGVSQNTTDGWYLYADSSNGKFGDTADILTPIISLTGPKCTLVFWTHMNG
ATVGSLQVLIKKDNVTSKLWAQTGQQGAQWKRAEVFLGIRSHTQIVFRAKRGISYIGDVA
VDDISFQDCSPLLSPERKCTDHEFMCANKHCIAKDKLCDFVNDCADNSDETTFICRTSSG
RCDFEFDLCSWKQEKDEDFDWNLKASSIPAAGTEPAADHTLGNSSGHYIFINSLFPQQPM
RAARISSPVISKRSKNCKIIFHYHMYGNGIGALTLMQVSVTNQTKVLLNLTVEQGNFWRR
EELSLFGDEDFQLKFEGRVGKGQRGDIALDDIVLTENCLSLHDSVQEELAVPLPTGFCPL
GYRECHNGKCYRLEQSCNFVDNCGDNTGENKCGSSCTFEKGWCGWQNSQADNFDWVLGVG
SHQSLRPPKDHTLGNENAILLMRRHKYPIRSVNLHTVKHVLKAQTVGNCSVSKLEARLLD
FLSVPNENTFGSSDHMNWHFMYLEATAVGLRGDKAHFRSTMWRESSAACTMSFWYFISAK
ATGSIQILIKTEKGLSKVWQESKQNPGNHWQKADILLGKLRNFEVIFQGIRTRDLGGGAA
IDDIEFKNCTTVETYIQRWECLRLEMHYKNTF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]