dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|48255962|ref|NP_689673.2| (Homo sapiens )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein LOC146723 [Homo sapiens]
Sequence length 243
Sequence
MDELALSFSLTCLLPENRASLSPSQPLSFQCLKAPATLTWEDEKQQRWGQPHGPVSSPLL
GDHRCLVPFRDLNPSSEVNTANLLESPSSLLLTSCYICSYFSFYILGEKRCHSLKRLRYS
VCCKVCPNFCACGKENVSGTGQVCTGVHVGAKEQEEPGGTQALRSCGIYCLEERTDKASH
EECRERSTLGRPQCTGLTPSLAGESPCPRLLPGSPTVRHLIASSCPGLSDPLPLPPGTLP
LGS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]