dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|390939165|ref|YP_006402903.1| (Desulfurococcus fermentans DSM 16532)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment translation elongation factor EF-1 subunit alpha [Desulfurococcus fermentans DSM 16532]
Sequence length 438
Sequence
MSAPQKPHLNIVIIGHVDHGKSTMTGHILYRLGYFDEKSVKMIEEEAKKMGKESFKFAWL
LDRMKEERERGVTISLSYMKFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAR
KGEFEAGMSAEGQTREHAILARTMGINQLIVAINKMDATEPPYSEKRYNEIKEILGKFLK
GLGYDISKIPFIPVSAWTGENLIERSPNMPWYNGPTLVEALDLLTVPPKPLDKPLRIPIQ
DVYSISGVGVVPVGRVETGVLKVGDKVVFMPPGLIGEVKSIETHHSKIEKAEPGDNIGFN
VKGIEKKDVKRGDVAGSLDVPPTVADEFTARIMIMWHPTAIAVGYTPVIHVHTASVACRI
TEIISKIDPRTGKEVEKNPQFLKQGDIAIVKFKPIKPLVVEKYADFPALGRFAMRDMGKT
IGIGQVLEIKPAQVNIKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]