dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386836240|ref|YP_006241298.1| (Streptomyces hygroscopicus subsp. jinggangensis 5008)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence length 947
Sequence
MGSPKQRGVLALLLAQPGCPVAMHQIVDALWGEDPPASAVNVVQRHISALRRMLEPEMPS
RGTSRWLVSGAGGYRLDADPDSLDLLRFRDLRGRAAASLRDGDQGETTDLLLEALALWHG
PTASGIPEDVRRHPVFTSVDGEHLATVKEAADLALQATGGDHRARALVPLRQTAVQYPLD
EELQARLILMLAATGHQAEALEVYQCVRTQLFNELGVHPGPQLRSAQQRVLGRAFGEAAK
PRETPADAAHGRSRTPKAPPSDTPRDTMPSPAQLPPDLASFTGRAEELDVLRALVPDEPA
STVVISAIGGMAGVGKTTLAVHWAHQIADRYPDGQLYVDLRGFHPAGSIMSPAEAMRSFL
DAFEVPAQRIPAGLEAQAALYRSLLAERRVLIVLDNARDTEHVRPLLPGAPGCLVVVTSR
HQLYGLVAGEGAHSVTLDVLSEAEALRFLSHRLGAERVVRETVAAAEIVASCAGLPLALV
VVSARAVFNPTLSLASIASELRDSGDSLQAFAGEIPAADARSAFSWSYRLLSPAAARAFR
LLALHPGHDCSLTAIASVAGQPPGRVRLLLAELVRAHLVSETAPGRYSCHELLRAYGVEL
GRSEDAPAELGAARRRLLEHYLHSAHAADSVLAPSRERISLRPGTAGVTVARFDDRAGAA
DWLDANRSVLLAVIEESAEYDHAEYGWQLAATIESYLDRNGRWVEQLAAQATALSAAQRS
GDVRGQAHAHRALGFAHGRLERWTEADEHLDRALILFAQLGDEAGQGRVHRYCAFLANAR
GLYRKSLEHYERAGTHYRSAGRHSGEASVANEVGWTYILMGDYHRALLECGRSLASHQDL
GDRNGEAAAWDSLGCAHLHLGDHDRALDCFGHALQIYRAIKDRYLEADTLVHIGDTHSAA
GRSTRAAAAWRTGLEILEEIGHPDAVPVRAKLKSTADSGSAKGCERR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]