dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386836909|ref|YP_006241967.1| (Streptomyces hygroscopicus subsp. jinggangensis 5008)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence length 974
Sequence
MTGLSRESADHAIQFSVLGPVRVWRGGGELLLGPKQQRLILAVLLARAGRPVSMHEFIDL
LWDGDPPSSATNAVHRYVGALRRLLEPDLPARSPGRWLARQAGGYLLRVDADCLDLLNFR
ALVDQARQADAAGDPTGSVGLFTTALDLWQGRCAADLEPVSSTRPAFVMLEHEYVSVVCE
AADTALRCRRAEAVLLPLRRAAERNPLDEALLARLLLVLASDGKQAEALAMYEEIRLRLA
EELSVDPGAELRAAHERILRHRFDAGAPAEAEEDEGAAYGPPVPAGSMPSPAPSPRTARP
AQLPPGLPGFTGREDALAQARALAARGGGALRVLAVDGIPGIGKTALAVHFAHQVASDFP
DGQLYADLRGFAPDGKPADPADILQGFLDALGVAPQRIPTSPDTRSALYRSVLADRRVLV
VLDNARDLAQIRPLLPGTGNCMVIVTSRSRLTALAAAHGAHLLTLDVPSPAEATNAFLER
VRASRPDATAREVRPLVERCGRLPLAVAIVAARAAAYPERTLHDIDLELSTTDHSLDGFS
DDNLDNDVRGVFSWSYRTLGPQAAHLFRLLPLHPGPDVTAAALASMAGISPHEAVQAMGE
LVRARLLTVRARNRYRAHDLILAYAAELAAQYERDRPAVRSRMYDHYRQTAHAANLLLRP
GPQPASPAAPLPSVTPEPLADTATATAWYTRERAVLRSVVEAAAAHGDSRMAWELAVTLQ
MCQQRMGWWHDWAATMRAALAAARKAEDAEGMARTHHGLAGALHSLGDLPGALRHLEQAR
RRFEQLRSTTDLAHVLGNIGVVYSSQEDHVRALRHMEAALDLLCGPEPRHLRAATLSDTA
MTRVKLGDPEGALRLARTAVVMFRDLRDLNGEGLTLTIIGQVFRRRRDYARSASYYERGI
ELMRLAGNRGNVAEELMALGDVRLDARDVAGARRAWTDALRSLDDPELPLAARAREKLAL
LDTVEEQREAASVI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]