dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428308575|ref|YP_007119552.1| (Microcoleus sp. PCC 7113)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment alanine racemase [Microcoleus sp. PCC 7113]
Sequence length 406
Sequence
MRQKLKQTNGVTYRQIESDFPRTDKGFSDLCQRAWVEINQGALSHNVGQLRKLLSASTQL
MAVVKADAYGHGATMVARIALEAGAHGLCVATLQEGIQLREAGIEAPILLLGAMNTPEQV
KAIAHWQLEPTICTPQQAWIFSETLSELQKTLPVHLKLDTGMSRLGMPWQEATQFVELVK
RLPYLEIASIYSHLATADSPDPTIMRLQHQRFEEAIAQLRHAGIKPPRLHLANSAATLAD
SSLHYDWVRAGLALYGLYPAEHLRNAVELHPVMQVKARVTQVKTIPPGTGVSYGYQFIAD
KETRIAIVGIGYADGVPRNLSNKMTVLIQGQQVRQIGAITMDQMMLDVSAISDLETGEVV
TLIGQDGNLSISADDWAQTLGTISWEILCSFKHRLPRVAVSDGMLA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]