dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428310154|ref|YP_007121131.1| (Microcoleus sp. PCC 7113)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Mic7113_1869 [Microcoleus sp. PCC 7113]
Sequence length 1150
Sequence
MKGKAPVRKALPWAVTLITVMELLGGVPAPVVGQANPPQSAQQSAELEEAKRLNQQVVQL
INQGQYAAAIPLAERTLDILEKVLGKEHPVVASSLNNLANLYVEMGNYSQAEPLYQRSLA
ISEKVLGKEHPDVAQSLNNLVALYHTQGNYSQAEPLVQRSLAIREKVLGKDHPDVAQSLN
NLAELYKAQGNYSQAEPLYQRSLAIEEKVLGKDHPEVAQSLNNLARLYEVQGNYSQAEPL
YQRSLAIREKVLGSEHPDFATGLYALAVLYQAQGNYSQAEPLYQRSLAISERVLGSEHPD
FATSLNGLASLYIAQGNYSQAEPLLQRSLAIRERVLGKEHPDVALSLNNLAGLYQVQGNY
SQAEPLYQRSLAIREKVLGSEHPDVAQSLNNLGGLYNAQGNYSQAEPLLQRSLAILEKAL
GKEHSLVATSLGNLAILYQYMGNYSQAEPLYQRSIAIEEKVLGKEHPDVAQSLNNLANLY
NAQGNYSQAEPLLQRSLAILEKALGKEQPHIATSLRNLAWLYQAQGDTARALEFKTRATN
IEERNLALILTTGSEARKRAYMATLSGYTNANISLHVQGVPNNPEAARLALTTTLQRKGR
ILDALTDSLQTLRQNLKPEDQTLLSQLADTRSQLAALIFNKPEDIPLEQYQQQVATLKAQ
AEQLENTLSRRSAEFRTETQPVTIEAVQQLIPTDTALVELVQYKPFNAKATKQNEKWGKP
RYVAYILHSKGNIQWIDLGEAAPINQAVEDFRNALQSPTSTIKPIARTLDELLMQPIRQK
LGNTRTILLSPDSQLNLIPFAALVDENNRYLVENYSINYLSSGRDLLRLQNHTPSRSESV
IVANPDYDKPGNPSVKIASQRGTSPPTPLLRGEGSRSNSNLVPPFPAREAGALVRRLGGL
GQTRSTENQRSSDLSQFQFGPLPGTAKEAAAITPMLPGVTLLTGSDATENAIKQLQAPKI
LHIATHGFFLSDVELVAPADFGGSTFLSNRGLGVEARPGIVPNSPPGKTENPLLRSGIAL
AGFNPRQSGTEDGVLTALETASLNLRGTKLVVLSACETGLGDVANGEGVYGLRRALSIAG
AESQAISLWKVSDEGTKDLMVSYYQRLLNNVGRSEAMRQTQLEMLQNPTYQHPFYWAAFI
PSGNWTAMGY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]