dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374983854|ref|YP_004959349.1| (Streptomyces bingchenggensis BCW-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence length 397
Sequence
MADTRLIQGRYRLLDLIGRGGMGEVWRALDESLGRRVAVKCLKPMGQQRDPSFTDVLRER
FRREARVAASLQHRGVTVVHDFGEHEGVLYLVMELLEGRNLSQLLEDNEQRPLPVPDVLD
MAGQLAVALAYTHDQGIVHRDLKPANIMRLADGSVKICDFGIARLGHDIGFTARLTGTGI
AMGTPHYMSPEQIAGGAVDHRSDLYSLGCALYEMATGAPPFDVDDAWAVLVGHRDTPPEP
PRRHRPEIPEPFERVILDLLAKDPEDRPRDAADLAKRIALARATWGAGQPLVPAWTLPGL
GADVPAQRQPRLPAWARHMTTGTAAGGAARPGTRPGPPGEAAGLTGAWTGRGGGAGAGGL
TAAWAGGPAPPPAGPPAPAGPPAPAAPAASAGPAGPP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]