dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374985147|ref|YP_004960642.1| (Streptomyces bingchenggensis BCW-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein SBI_02390 [Streptomyces bingchenggensis BCW-1]
Sequence length 59
Sequence
MTDRDLLGGRYRLLRKIGLGGMGVVYEALDSTLDRRVAVAADWPICSRSPVTTSRRAKC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]