dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|385805558|ref|YP_005841956.1| (Fervidicoccus fontis Kam940)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 30S ribosomal protein S3 [Fervidicoccus fontis Kam940]
Sequence length 251
Sequence
MVNIKRYFIEKNMSVVKVDEYLAKQFYRAGYAGVDVYRTPLGTRVVIRAERPAFIIGRRG
QTIKTLSNVFENYFGLENPQITVMPVENPDLNARVVAFRLAVSLERGFHFRKLAFAALRR
IMAAGAAGAEIIISGKITSERARYEKFRAGKIYKTGEQATYIVDKAVAHALLKPGIYGVK
VIIVKPERTKDSIIIKSPEEIGINKESTAKEKEQKEEMGEQISTQAQESSSQQVLQPQEE
STEEEGEGETQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]