dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ML00541a-PA (Mnemiopsis leidyi)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep supercontig:GCA_000226015.1:ML0054:1665:5609:-1 gene:ML00541a transcript:ML00541a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 433
Sequence
MAASAWLLFSLICLNLCNDLVISAAISGVNPGETPEEDSALNNATPDGESTKSSNTTFPT
KTSPPAAITTLNSTTGIASSTNSSLTTTDRPISTTGRPISTTGKPSSTTGRPSSTTRSSS
TTPKTSSTTRSSSTTPKTSSTSSSSTTTAKTSSTSSSSTTTPKTSSTSSSSTTTPKTSST
SSSSTTTPKTSSTSSSSTSTGRTISTSSSSTTTAKTSSTSSSSTTTPKTSSTSSTSTGSS
GSTSKTLSTTYPSSSSYSSSVTPTEEPDRCATVGKIPCLGYPQICIPETWLCDFEEDCPY
GTDESNCDGESDDGLDGGKSKPGGGKVFIVDPAQPTNRPFEPNCRWQGGMACPSETGRCV
PQNRICDGILDCSDGEDETGQSCLHKQVASLEKGVAKLGVKVAVFLLQTKEAVSVSIKSI
YCKLLNSEACKNL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]