dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|336179551|ref|YP_004584926.1| (Frankia symbiont of Datisca glomerata)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional DNA primase/polymerase [Frankia symbiont of Datisca glomerata]
Sequence length 300
Sequence
MSGPAPALLAAAESYIEAGWPVFVLGRTKRPVANCPRCRDAGRDHDPEACACLSCHGFYA
ATLDLDRVAAMLSAAPRGLLAIRTGALAGLVVVDIDPGHGGRLDPALMTPTAAVASGGGG
WHLYYAHPGPPVLSRRLPGRTGVDVKADGGYVVAPPSIHPVTRTPYRWTARQTVGEMPPP
LHAAVTAPAAPSSQPTRPPATAGPPARRPTGGDDSAGGGISRPDLLLAAHLAAVARAPEG
HRRTTLYGAARGVARLVAADHLTATEAWAALADAGRAAAQTEREIRGAITGGFRDEGVPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]