dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MhA1_Contig210.frz3.gene7 (Meloidogyne hapla )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MhA1_Contig210.frz3.gene7 MhA1_Contig210.frz3.gene7
Sequence length 213
Sequence
MQAKAKQLEEERLKKEKDKEGQCGPEEVPCPETATIRCIHYTSLCDNVDDCGDGYDESNC
VSSESRDEEKIITISPENVINAYCAPGEFQCRDGSCIPDSSRCNRNYDCGLTDGSDEEGC
AYWKEAEEAERRRKEEEQKQLAEYHEQQRQRAEEEKNRRIEECRRRGGFLCPGQDKCVER
SNVCDGRSDCANGDDEKNCPVSEEETGWFINFI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]