dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSNLEP00000008223 (Nomascus leucogenys 76_1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9433521:9434970:1 gene:ENSNLEG00000006753 transcript:ENSNLET00000008611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 81
Sequence
MPSQTLLPVLVLCVVLLLLQAQGGYHDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHR
DCQANNICCSTYCGNVCMSIL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]