dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374311118|ref|YP_005057548.1| (Granulicella mallensis MP5ACTX8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RNA polymerase sigma factor [Granulicella mallensis MP5ACTX8]
Sequence length 204
Sequence
MSKGAPLSAALEGRGDVTSLLALWSRGDDSALEQLTPIIYDDLLRLAKAKLRREYGDCTL
EPTGLVHEAYLRLAGQSKVHAESRIHFYAIAANTMRRVLIEHARNHNAQKRGGGMRITLQ
TGMDIAQERPPDFIMLDEALGRLAQIDKRKSQTIELKYFGGLSTEEIGLHLGISVATVGR
ELRLGQAWIRREMSGALIDNKDEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]