dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374313364|ref|YP_005059794.1| (Granulicella mallensis MP5ACTX8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ECF subfamily RNA polymerase sigma-24 subunit [Granulicella mallensis MP5ACTX8]
Sequence length 214
Sequence
MRADLSSPENFEALVREHQGLVFRTLTRMTGGGPHVEDLAQEAFFRLYRALPDFRGDATI
STYLYRIVVNLAQDEWKRRRKERTHLASEPLSPEGEEESSGWIENFAGDSLASEHARTPE
QRLSDAEMQSAVDAELLALPEIERSVLVLYHQEECSYEGIAVALGLPINTVRTHLHRGRK
RLSERLRSRLAVQPHPKEGSSNGPATGAIMAGKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]