dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|336453853|ref|YP_004608319.1| (Helicobacter bizzozeronii CIII-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Recombination inhibitory protein MutS2 [Helicobacter bizzozeronii CIII-1]
Sequence length 739
Sequence
MSLIAQLDLTRFIEHFSTFLARPKDFAPSHTPPNIWEHLQELEHLDCTPPPALICLKDAL
KAFKKGGVWRLDTLFAFVQITRYFAYLKALASPKQHPHLYAYLDNIHFPPALLELSTHMQ
DTPTLKSGFYPDLDALSESLARLQAQQKKLLNQILNKSGLQSYLVDRQVHFVNGIESLLV
KPGFSVAIKGQVILRSHMGYFYIEPLEARDLSRKIQEVQTKIEENLARICTHWSGLLRPH
FLFLRFINHEFDYIDHIIARVQFAKSANLSFIKPNNRGDFTLSHFAHPNLNNPKPISLRF
DRSLLLITGVNTGGKTMLLKSILSAVFLAKHFLPFKIHAPTSAIPYIEHIQAIINDPQNS
QNDISTFAGRMLDFQRALNTPQLLLGVDEIELGTDASEASCLYKVLLEKLMTQGAKIVVT
THHKHLALLLAKNHAIQLLAAHFDPQAQLPTYTFSPGLIGKSYAFESALRYGVPLEIINQ
ARALYGAEQENLNALIERTSALEQELRVQHAQLEEAKKAHSQQIQEELEQLQAKAQAQQA
KQNALEKSYQQALRALQDALKEFERTQNKSHAHQQIQAIKASLTQPKPTPKTTTNPPALT
QGACVRYKNQLGSIISLNKESCLVALDNGLKIKINAQELTLATPPKIPPQVKLERKPTAQ
ASMRLDVRALEVLEALQQAQDFLANALLAGFEEVLIVHGKGKGILRQALREWLKKHPKVI
AFEDAPYNLGGSGAQVVKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]