dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|383843178|ref|YP_005423681.1| (Rickettsia typhi str. B9991CWPP)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Sec7-domain-containing protein [Rickettsia typhi str. B9991CWPP]
Sequence length 454
Sequence
MDSLLKNEVIKLFNDKQKSGITRIKKWCADNNKDFIEETAKFFYEEKSNLNLEFVGDYLG
TDGVDNQKVLESFTKKFDFKDKDYLESLRRFLQSFKLPGEAQKIDRLVESFGTHYYEQNL
NIDINSKDAAYILAYQAIMLNTDLHNPSIAKSKKMTFEQLKNNLKGTNENKNFNDNFLKK
IYDEIEAKPFKLNFVDSSPGYQINNISSQNDKVFKQLNQFLEEKRNIQNIFPKLQNNNLT
IEFKNAKTFLNKFTGYKGNVIIQDEQCGKAEIQVYKPSIFSRWFLGEKSKIIIQPLREDG
KQPSEQSLELAAQITASFETEVTSIKATYDYLKEDLKSKYDNIRNAKQELERISTIAEGH
KNIKTEVVYQINQPVKNSVAVSTISVVSPMSKDDIHINPPPLPLPKSIPNVVKKAAKDIS
KQIPQERDNHKEELSKVLEVQRKKIDKQNSGRVV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]