dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_01465T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_01465 | Salpingoeca rosetta NOTCH2 (2165 aa)
Sequence length 2164
Sequence
MPKPVTKKHVTPQEIVEICACLRNMRGQGTLTEKETLLVLHVYMQLKLAHLENRRKSKGK
RSNGQVDERAAKQLGVGLSTVRRKYAMLNKLLQEHGIDGLKTLSVENRRGKATQLPTRVP
TTKRVLRQVRDHVRMQREGGHRITAVQVLDFLRKHRHVDVRPSFAGDGDDELDRAAALRA
VQRFLRRAGYLRGNKHVVQENPRHKQLLAKYLKEFDANRRLPPDERLREVYLDESYIDRN
YNRNRDSLYDPNDGQDMHSHRKIKRGRRYCFALAVQGPDPRVCTVSDRNDRALAGPVPGT
SWIFDPGSALQRHTRKKCPVAEEDLPQQPQKQPSTRKCGRCKQPGHTRKKCPVADEDLPE
QPQQQQGRPRKPPRGSFHTGDYHKAFNSDNFISWFKDALLPNLHQPSLIIMDNAAYHCTL
PPDTSVPGRMKKADVIAALRARNLTVSETDFSCELKDRLKLWVKNHVQPEVVQLAEAQGP
QGALLPSVLQRPQPNRARVGADQGNVGRRYSLDTTFEDVGRRLEEEIQRLAEDRGQYRKD
GKTRVQAIIDSIDKQLERQRRIIDGRGEEEAVEQAAPCTTTRAASADSTDEMDVEKAAAV
VLDEEVDWVDERMDEGEDGEEGEEYNNELVLRSDAAGVLDFETSPTVEVVVTCTDTTPQR
LNVTQGVTVRIGDVNEPPTGITFDGELREDAAAGMLLGELVVADPDVNDTHTIAGVGMDT
RLQLRGNLLYVRDDAATLFDYETEPLLHLHLVAIDSAGQFVQQLVNITVEDVNEPPVDVT
LTPTQPTVVENTVPTTRIGQLSALDPEGSGPVTFRSGVPAVLAVTSDGNVTLVAPLNFEE
SSGGADGVQWFGVVAVDATGLETEARIPIRVTDANDAPVFTEPAQDNAFITAPENQPVPV
DVGVVDEDLSDDLTLFLVEDPEATAVQITPCAGRTSPFTPCNATFTLPAQDYEGLVASTN
DNKRTYTLGVSDGTTTTTTNVTLVVEDVNEPPTLALITTTVQENTPEGEQLARVLVTDEA
DQTATCEVVSPQSQFAIDSSASSSSSMANGSEVVLRAGAEPLNFEEAQTASVTIRCVDSG
VPQRETTTTFTLTVTNANDPPTRIALSPTAVSEFASVGSTVAHVWAEDEDADAARFHRFV
ALSAGDPPFFVFGTSLVLSRRLDYETQRSHNITIRVEDTAVSPPLTLTQTLTVRVINEVD
CDATRCFNGGTVSTSQVKGLSACAHPGTGFRGDVCDEPVMCTAVPPPNAALVVNGSLVDG
DDASQQLAFMEQVGVACLQGYTTNGLVDGPTTFTEVCQDNGMVSSTASCIDADDCLAEPC
LNGGLCEDRVAGFYCQCPSGFSGDRCEFARDCFLDQAGATATVTTYEDLALLAECRVFHS
NVTISITAAPANATGDDTANATIAHLASLSNLQRVAGVLALRNNDHLVSLRGLANLTWVG
GLVLENNAQLRTVSGLSALTTIDGKLVVADAGPSTLQGLEPSTCGSVIIRHSSLVSLEAV
NLPMWLQGSFVLENNDFLLRVNGLAAVLQIAGDVIVRNNLRLMTLDGPSNLARVDGDILV
RDNTVLLDVGALASLQSYGGSWVIANNSNLCFIGPFLLENIASLEVNSDSEEFPDVMLAR
DDCPAERADTDGDGVFDDKDNCPRVFNPQQRDSDSNGIGDVCDCNEGSDAFCANGGTCVQ
DAQARHYMCACPVEFEGPTCNISSVYPVPQMQVEHSALFQQQPVRVSSVAFTQPYLLLPG
TNPEVITDSATTDTVTTRLSAAWASLQAEEDVDVPRQPAHDVVATLLSASTVWFDAPHVW
VHLQARDASFNMRTAATTVSITLSARVDTDGDGTKKDVSVQAWCEMSAASSGCITWTSVP
QSWFPLENSDGTPAAMRAVTVAYGIGASLSASAFMQELPGQLQLASRPAITARVRNTVAV
LVPFAPVYREDTTQLAVYAQADRGVSAVVLRMDMIDSDALRFVRVVAAPGWSARTSTSGN
TTLAISLQRQVQQSGGGGSSSYASPEVLCTIEMAVMPQAVEGRFSELQATVVGFVDLQGR
NLQLEGFYPLPSPALHLHRNRGVLASKSIGYVPVAANTLVALLPHLAQAELINTARLDGN
TVSTSLSRPTTRPLAGLRDHNCQPVYEDVFLDVSIALALGSPPSQLCLYTMYLSLRDDLW
NVYA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]