dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_01976T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_01976 | Salpingoeca rosetta conserved hypothetical protein (6238 aa)
Sequence length 6237
Sequence
MRARPVSHDRTGDTIAVPPTAPAMTAHTACPGGTWRSHSSGCMKSRRKTPLLPLPLLHAT
VAAMLCILFLTSAGTVRAATSCQPGEYLNINATCIECLTGYTCSGGVSAAMPCPTGTYNP
VPGQSSQALHCLACEAGDYTTARGSTSCQTCPAGHTCADPAAEPTECPQGSYAPAGSTTC
KACPAGSKCPYAQLAAPIACANGTYALANQTSCSLCPAGYSCPDASAAIACGVGYYSPQG
EPACTICPLGTFCASNTTEAPELCAEGSYAMLGQEACTACPAGYYCPHADEQPVACSNGT
YTSSTGAITCLVCEAGRDCSTKTSSTPCPAGTYSGQGLPSCEPCAEGYYANATGLSHCLP
CPPGYTCANPAYDPVLCSAGYYSEGTNGTSGAVCIACPRGTTSTPARTGCDDCPQGHHCN
DPTIDPQPCPAGTYSAGGTVKACTTCTAGFYCPAQATQPLPCVSGTFSGAGASNCTACPA
GYACSSTAAVPVACDAGYISDEGETTCRPCGLGNFCPSSTEGPYPCPVGTYTVNATSQSC
LPCPTDHACPSATATPVLCSFGQTVSATLTTCEPCPAGFSCPTPSSTPQPCTPGNYSTEG
SGSCTACPAGSACPTTSASPEACSPGSYSTEGSTHCTRCPPGYECPSTADTSLIKACRNG
TYALGSATACELCDAGAYCPSTSQGPQGTCPPGTYSLDGQASCTLCPAGSSCQYNDRDPA
ACAAGSFSEAGALECTVCPPGFACPYTTQAIMHPCDIGSYSEAGSTTCNVSGSAVNVCPA
GFACPSVYGDTRVSCATGWFSTVNATSCTPCPAGYKCPTSDSDSRTACDPGTYSLGATDT
CTDCTAGSYCPSVALPPRVCPPGTYSSDRATQCTACRAGYFCTTTTETLCNEGFWSAANS
TYCEPCDSGYLCDAGTRPHTSPNGNPCAQGGYCNGATRTECPDGTYGNVAAKGTLHEACF
ECPAGSYCDGTGAGATTPTACPAGYYCPAGTGRIDLQPCPAGYYALSGGSKESLDTGCTL
CPEGYYCPQASVNPIICPQGYFCPTGTEEGTQNSCPSGTYGATVGFSDASNCTICPIGYY
CPDGHNTHPSVSPLPCPGGTYNPFTGAGLEVDCIPCPSGRSCSGTGRNNTNPCEQGHYCP
RGTVTSTQYPCPPGTYTDSTSLGAAEECSPCPAGSACGWATGYTDNVPLSCSQGHYCPTG
TPTPTSFPCAAGTYTARSNLTAASECSTCPERYYCDGGEGSPTDWCPSGYYCLAGTQAFF
QHPCPAGTYQPEIGSYLESECFNCTVGHYCEEATTTPVACPAGTYMPYGSERNDTMGSEA
SRILSCKIACRDPDDFVSLTTVAELEQCELACEQGSNCATHCGTVSAEYTTACNHGCDSY
DSAAAYVQVGVSAGAASECITCPAGYSCSSATVDPVPCGRGFYSEAGSEACERCPAGYYC
DEAAVSDTVLVTSKACNSSLYCTSGLSAHDDAVPCPRGHYCPQGTALPVTCPVGTYNPDL
YGASLADCHPCDAGMYCVEASVNPTGACNKGYYCPTNITASEVLNGVSGLLIGSYGPKQE
PCPAGTYRNATGGQDLSSCATCPEASYCPIASAVPITCPRGFYCPLGSAQPQPCPKGTIG
NSTGLIAESDCEACPGGFYCDRLGSWQTTAPCDPGYVCTLGAVTSAPTDNVTGSICPAGG
YCPPGSAVSQPCPQGTFNNVTGSVDENDCVPCTPGYYCASTRSPGPTGPCDAGYYCTSES
KDRRQFVTPVGHYTTAGSSAPIPCNPGTYQTATGKGSCDPCPAGTYCPDFGMNSTVECPR
GFFCPEGSTSFSGPNGNQRCPIGTYGAFSGIANTTGCVDCPPGQYCASPEDGSGLMEPTG
PCAAGYICYGNAEFATPGLDGLSWGAVCPPGYYCPEGTQAPVPCPPGSYSNVEGLQSESQ
CTPCPAARYCPEEAMTTYGAYCAEGYYCILGSAVARPLSNNSVQLRGLDSLDYYYTTQNL
TLNTTRLAACGLLDFGGDVCPQGHYCPTGVEAEYIAGFPSFVWEGGPILCAEGTYANFTG
AAECWTCPAGFACFNREPFDANPLPCPEGHYCPQGTDSNIPECPVGTYNNRTGLQAETDC
TPCPPGLACTVTGLSDPDAPCAEGFWCGRGAFSTRPRTSSPLAATTPSFDGGQCPEAHYC
PEGSSAPTPCPPGTISAAVQASSNATCTACPPGFYCEAAGQTQAAAQCAAGYYCVSGATS
PRPTDGVTGDVCPAGTYCEAGSHTPANCPPGSYNALTGQSNCTTCPAGFYCEEGASDYTA
TPCDAGHYCPNGTAHSTQVPCPVGTYLNTTGAATEDACVPCTPGYYCPTTGLVQATLLCD
EGYYCSGGSHVARPQVNGTDVATCPGISAGGMCQAGTYCPQGAPAPLPCEAGRACTTTGL
SASNKACSAGFVCLGGAQTTRPTDGVTGYRCPAGYYCPAGSSEPTPCPAGTYSQASEASD
SSTCLACLLGHACTAPATTSPEACDAGYHCSVLGLNTTSPADLLCDPGYYCPNGTTQQLA
CPSGTYQNEAGMATCKECPAGFVCDATSSPVVTGTATPCPVGHYCPAGTEVGTANPCPVG
TIGNETGLANVTQCHACPPGHYCDEAGLTEPAGECAGGYYCQSGATTPQPLDGVTGDVCP
SGNYCPQGSINPVPCPAGSITTLLAQDEVGDCQPCDPGEYCPAGSSAGDCDAGYVCVRGS
ATAQPTTLAFNAELGVLTGGYMCPNGTYCPAGAISDTPCARGTYAPMPGLEACTPCPAGQ
LCEELGTINPADCPLGFYCEQGVVTPEPCPIGTFGGRTGLRDVTECTLCEGGHFCDETAL
TAPKGECDAGYLCAGGDTTPAPTGPTTSILGDDTNFFSVAFVTIFIDGEELNVTSGTCPR
GHYCTNGTASPVACPAGYYNPDRRGASLADCTPCPARYYCADTGMTTYTSTCAAGYYCPE
SAAIATSQPAGYECPLGHRCLAASDAPEPCPDGEYQDVEAQSECKTCPAGSVCEYGRNSS
VTPEPCPLTYFCEAGTGLYNKQLCANGTYGAATGYAQASDCVPCPPGKYCNLGVVEGNCH
AGYICLSSSTTPQPSGDDADVGSPCPAGYVCPEGTLSPQLCPNGTVVIEGLEQQQVVVTA
VNNDGDLISVTRNITVPTLGEGAASFDACDTCPASLVCAGAVVTPCPTGHYCPAESSEPV
PCAAGFYNALPASDDPTDCSICPAGYWCRYEGTSDFSDVPCPQGYYCPVGTTTPRACPPG
TWSNETAAMSADDCQECPAGFFCPENATTRVVDVCPSGHFCPAGSAEPRVCTAGYYCPTQ
SGEPRPSPDGYYSPFNSSDPIPCPAGHYCPAPAADASTVIGDYPSGATEAILCPLGYRDR
VEGGGNHDRTTLDSACVACEAGKYGSHPTRAVCFDCEPGFVCLEGAIYGNPDVWTAVNAT
RDRIVYVNGNPYSDVVALDVLPYTGVGFNYTVNGYPDTKSYQCPPGYYCPRQSPYPLPCP
EGTYNPNNRSVSVDACVSCPAGTYNNRAGQSFCRSCGSSSFSDSGASLCTCRGENRVFSP
ADATCVCRPLYASRDGATLLTDVEDGVADCQPIVFDNCPEGSVLNEHGQCLDDSGWLAYC
QAECALGPTPSVYDAGLGRCLCKTPALDDVCDISCRAEERQRQQIVCESPPRLVINQVNA
DGSVDEVISIYTSELGVGALGDIGLDACPTLDGRRLPSFLMVANSDGLTGGYNVPTTVWE
GLDVSGASRRRRSSDAAAQSMDGAQGAAGHAGSTVLSSNLTLTAAADGELPRARRPHVRL
RREEWVAQLANPVACLELGAVVVFSVNGTNYPVYDKNNLLNRQDDPERPFIHAPLVALAE
ELQSDPSARSFAYAFTSPGVWVLRDAGSGRTSVFSVMGENVECPDNGPFFPATSSSQHLL
TVSREDSLVVTPDWRLMGFILAGAAALVMVVLAATSYFRTAGWVVEGQRTVSYRQAATRY
PIEDMSSKGSQRERVQRINRKALEFDLSDPANEPPPQGKSTASNNNNNNNNHGADADADA
AGAEGTKEGVSQRLKVLFDDDFWDYERQVDLENFTAETLFDLIDGRTQEVHRQIQAKSDE
VKKVYENIRHEASLLKSLWVSKLRLARPVELSPLPPGQPSNTQTLSKARDGYGKELESRK
SLGDRWYQALVARRDMLARTFRQSNDLYQDVLSRVEEVRTQVNLVIALQRFAQQQRMDNS
VVAEGRVRCEQAVIGLREALIKGTAQLLCSSLVGESDVESFGARLLPPEDGGDEPVPTEQ
LRDPVDGGLVSGEFIQRSEILPGLFVPVAGTRLLLADGSVQPCSPTEHVVDPRTARVLPV
RGNVAYNMVTRQLFVVVDFTSISTHSAPLLYVPWPAQAQAQDKACAFSDGTPLQSSLRTD
GTMVHAATGLTVPMLACTTHPATKEIVPVGGVYDDPVTHLPTPIQRYLPGPASGHANTII
VDVDISDEGDAVPVCVPMGNLDTHTHIASEEPLSGRVCLSNHVSLRTSAASPSGSAPVMP
KPHGVSWVSGLDALCLQSYRSCLTEVERLPVLLADEALDPLALSSSLASAVSSMDSQLRD
VHSIFKRTARLKHSLFSDILLRFAEALSIREDGGVLGHLDEGNVPLFVGQRLYDRESKLE
VPVLGVAYEKENERHVPLGGVMHSPDTGELAPISIGAAYVDPDSGEKSRVQGARVDPNTG
RVVPSRQPCVRQRTFKLTDDDLARLEEELAARRAWQRRTTNQDNGLLRELQRLMATVLEM
DDSETSKVSSHLETLAETLTSRSQQMRREQKRRKEEEGRFDEFPGVLTAMLFSNDKQEAS
LSVRHLQQFENVLGACKRFLAACTEAQEERDNAYLPERDGADNTDLKDKAQTAFENALDG
ARLELLESLSMQLAHVHESRATLQWISVDDELRASVVKEILGKMLRQQDRAQSGEDDGQN
TMTSLENLISVLQHQASILRTQSTTSTTGLSASGRFTLAQLREEAEETAPASTTPPKQPR
MAVPAIAVVEEGDDAETDGTSAGLQTQQAEQQQQQQGADSGSAALEVGKAGGMKKTDSKK
KKKKKDKKDATGTLASKELEKLVEIQTQGRTALDARLYEAEREEMDKLLEKLRKEEEDKL
GELTADLMRKLVAAGDDEAAQQKLLDAYEEQVATVRKQHQAKADMQVAELMQRLTRIRYD
ETQRHYQRERDTLPNHPDIAPPPNVTEDDVQAQIKEMLLEQQRLIASLEAGKRASAEEAD
QDGQGGGAVVDFDKRMEAFANSLTNKSTLRGGDKDAEALAAASTTAKKEVASRAKVVTSV
KGRLRAKLEKRRAEAVGKAKTDEERAQVEASYDSQLATLSSHVTKAVDDELARTQQQLVK
EFVAEDKQEEAAQMLREHQERMQQVRDKVHSDQRDKVMARIAAQKRLAAQRRRERMQKQQ
QEKLAAASGSGDGDDEGSKAKGSAAAAVDDGSKHARDLANKVAAASVSDEEAKKRMAELE
QAHLKRLEELEAQKQAQMKELSQKVDAEITEAQQKAEADLQKRREESMQAAEQRMREEQE
RAKAQLSPEEFEKFMNKHRQQLSEVQSRLDKTQQAQRQALQERLKKQRERRRKANESKLE
EQFTTEMSKQSEEREQLQSDMERANEEKVLRAAVKDMSNSLSVDSAAGGGGGGGQSTHRD
TVIHRVMRARHLREFGRLVERCAVDMEARLRQDVGNFREERAEEREKIEERYEAELAEVE
ERDASAKTGSRDERFKIRRKLKTALANFDKKTARLVEQLEARVRLSANTDTERRKLELKQ
RQYNEMVEAFKNFSPDSEVHAQYEEAANQAKEAAEEYKKRLGAERQEQMKKLKEEQERLR
KERHEKMEAERKRVLQELEAERQKQEQLMQQKQQRNKKKMMEQMRQQQAHELEKLDEAQR
QEVMERHRRGLKNLEDALESEQDRQRQKFRERLNALKARKQEARLRELEEKEEEEQARAE
EEFMAKELELQQQLHSQVQATVRKRDLRPTTPFVAGKGKKAKQPGGAKKQGQRRKSRAAA
ADTAAVSMLDEGLAPMLSKIESIEALLAGYDGAVAGQLGDDVEEEWASRSGDAALFTNKD
DDGSAGEVDVVGDDEATQRQRMSLQLAEFVCRVARERRWLDNDVRLQLAKRLPAPVHLQN
AFRFSYAYNRDTRTLSVRAQRADEPTQLLLVVIHALAHIKVDNMDGDHTGVFRKAFHSLL
RLVCFDVLLSGCIAPASADGGDGGDDADRLQLLLHGLQRQSQSSKPLVKLLDDFSHA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]