dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_02374T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_02374 | Salpingoeca rosetta predicted protein (1083 aa)
Sequence length 1082
Sequence
MRLVVRTAVAATVAVLTIAYALSSLHCTAYEHYEITAIPFLDYCKKCTFGRYKDSVGNFD
CYPTRRCEPGHRYKHVSKNQDATCPACESGKYQAKVNHRDDNCYTWSTCAAGKYVKQSAT
TKRDRSCDACPAGKYTPRSNRLTCSDCPSGKYQDNSGRSSCKTSTTCDDGYFSISEPPTS
DRICAKACSPGKYSTLQSLDTCILCEPGTYQDQSGQTGCKPCVDAYQPIAGQYSCITYNT
CGAGTKFKAGSATADRTCEACEAGKFRASPSHKYTTCLSCPPGTFQPKSGQSGCLSCFEC
TIGYAEDTPCTPSTDRTCTDKDPPAIVLRRPDNNAVITNTYVVEATFAFEPPIFTATDAA
AGAVTKTLPPNIDDIDTSTVRSDQMLTYKATDANMNTATRTITVVVVDTTGPAITFDPAV
LQLEAGEEVMRSNFTVGVSIVDRVDGTLGINLLEYDDSDVNVNTLGMYEVVYTLSAPDSN
NNEAPPTTRTAAVVDTLAPVITIGFGDRDVSEHNVVIHEAATEFIFPSQSAFDTFDTAVN
GGDVRRNEEPTFSSVVDDGTQFTFTYTATDASDNTATVVYVIEVRDTMAPTITINGEHNI
THEAGTEYVDAGATATDLLEDAIGRGVEVVVTNNVLSKPPSAPAVFTVEYDACDKADNCR
LAIRTVHVLDRTAPVVTLYGAEEVHVPYATRYVEAGYSAQDVHDGNVTSQVVVSGADVID
VHVAGTYEIEYAVMDASGNTGVAVRTVVVEALMRPEQEDVVVELVLAGMPETIFGGVLQL
ERDLEEALNVEIVVVFNVKDGGMRKTAPGVSTSATVVEFGVRASDTLQWRDAKVFADDLA
QQVAFVGDVRVLGASVAGSMSSSSSPSRGGSVAGPAAGGVAGLLLLVVVAAVVLRCRSRT
AKSRLAAPGAEGAVTMNPTFEGGQVEPEEHVYQVPARLLATMPGSAKNTRRHTRWDPSFY
DVGKSETQQQQQQQQQQQKPPPQHQPQPQQPLQPQRKQRKQHDGAENVRGTGERDEDNGN
RTRPQSIHAWSSDLYDTHEGSEHALTFRVAVPTHSSTLASNASRDIRDAPVYDVVEVVHS
RR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]