dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_05491T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_05491 | Salpingoeca rosetta tyrosine-protein kinase SRK2 (2191 aa)
Sequence length 2190
Sequence
MVVCELKPIVPPPPVSVTKGNFQYYTTFEMVTYADARSVCHDWNEDAYLTRVESAAVEEL
LFDLMKTADDNNDWDLPPNPRMWIGLQRPGDRSSFKHDMNSRDYTSSDYKSLEYGDGDCG
TMSIESSPRWLRRSCSNNFLFVCRVTLYDCFAGTHYDASSSTQGCQECEGGKFTSETNEP
RCETWDDCDNQDNDRGTRLFLSPSFTSDRQCFDCTSDEERVEVANSYYACVCEPGRYRGE
SSFSSNVCVECAEGTFKKDPGDDECEVSEPCGYGLEEVAPVTPTSPRECRECVQDVTYFS
FDTNKCETVHPPCESPEEETQEPTKLQNRVCKECVQFETFYNSTTKKCQSVSSCPYGEEE
ITEPTLTSDRVCEPCILGETFYDGNSEQCEPVTSCPLGTVEYEEPTLLSNRKCRSDAFTC
EDGNRTSNGAACNCTDIADACSVCHRDLQLEPAYGLVGRMFNAQPTETRLISQLTLDASV
TDALAFCTDKCRVQYASEGCVGFTLTTGSMRQCLFVSWFENESVDTAGANFYTLPACDRC
AERYAIDNRGCTLTATPPVLSVADRRVLIPLSQPAGSLITTVAATTDAPAGQDDITYSLT
TPDGFADVFSINATTGVITLTKQLQTPAAPVLLVTARDSRTECNLLVDGTLVKNDGSCVS
ETMDITVSVVALLGCPRDINEYVVSQNEVEVSWGVTPSFPAYLTDLELVLLRNGNESDAT
VTTVMVPVGTTNFTYRSNETVAGEYIQCSFKVSVRKGFFIQVDDIDLRQSGNASIAYSLS
SPGIADASRLPTFESDLTSSFFIGFRTTTGRPFSLSLTEDLQADINVALRWCTDNEPFPT
SVPPTATNASVGVTFAGVTTNGPLPVFSDEGTWVYQTAQRSCVNLIASSQAVTTSMSFVT
MELQFNPLPVARRRRADPPTQLFIPAFPSYVAFELSRIDGEPATVEELAGALTTKDVIAP
TFLDCPPPLAARTFNIDTMGQVETLVELPKLTVYDAIDPAPVVDPATYSSVLSAVDSPHS
VTFTASDSSNNEAQCTFDVFVTVPENVLQRKEVVTEWAYPIERRIVPDLNLAFYTHRIHG
TGPVSSFQADMSMLTGLNMTFETKNDELPFVVRERAQAARGRFVVDMQWEAAGKTPGFIY
EHQESASAFLVVRGFKYSDDTAAPVTKKFALPEQLVAVRESDGVVGVVGRTDAFTRPFTF
TSATLVLRFLGVADDNLGNVTWTLTKDSHVGVEYEYSYNPNKGPLAASTVAGFLTLLDST
PPIFSFCPANISAPTNIGKNYLTASWPSPVATDNRNRTYLSSNFASGHRFPLRKPGTGPW
TVMYTATDAFGNTAPCTFTVTITDTERPVPSPSHTVYKTLPATASTVFVGIDELMPASVM
DNAMMTDQAGDPIPWTQPRLTEDNTPDNNRYGLGVHMVELWFTDAFNNTAPAYTFINVTD
VTAPERVTCPGSKGVSTPLDESAAIVNWTMPTFRDNSGVPPVVTSSHVSGSEFAIGKHTI
TVTAFDASGNEALIPCTFEITVFANVSAPPPPPFSNSTIGPFASRSQDTGVIAGAGAAGG
LLLIGVVMGIMFVNRIRARSRAPQNWEDIFKLMDQFKDCEEGPRYPRELDRAALKLLEEL
GKGAFGVVYKGLLKEHAHIPGYLVAVKSLHEKGTLADRQELLEEAAVMAQFVNPHVVELV
GVITVGKPVYVVTEFMEHGALKSYLEDNDVPVDKLVMWAGDCCEGLAHVHGKGFIHRDVA
ARNVLLSSEMRCKISDFGLAREIEEDDTYYKSRGGQLPVRWTAIEALEERKFNEKTDVWS
CGILLYEMWTRADLPYKGWSNQKVWVEVAAGHRLSKPDGCRDDVYERMLACWSESQDDRP
TFAQLSEFFRTLYKELTGEDLNAQDYLEVDATAETEPVEKKRGLKGLLRRLSGKHFSNPL
YKADADDGDDDGDNNNDNDDDPNAALYDMGEDEPTAPLPDERDENADLYDMGDDNNDNAF
TTTTSLGALPEEEEEEEDQNGAEGADLYDMGDDNETGGTEGADLYDMGDDEPQMAATSFR
PQQDLEGADLYDMGDDSAGTAPVKENISGFGFQETGFGMAAQQPPQQDFSQDLYGNMGND
DNEPATTTFGRTAGDVSAADVGKRVSVQGYACKGTLRFFGNHSVTRAVRCGVELDQPLGK
NNGTVKGHKYFSCKDKHGVLCHPGKVSVIE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]