dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_06436T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_06436 | Salpingoeca rosetta predicted protein (3260 aa)
Sequence length 3259
Sequence
MGVNDAPILDLDASSPGSGYKAVFVEEQGAVAAVSPTDLVLIDVDNATVSGAWARLWSAE
SASNADAQELVTDTSGTGLSWSYDSASRVLSVSGVGTTAEYATVLSRVQYNNMEDEPHPA
NRTVTFTVSDGLATSTPVNSTIRILLTNDPPRLYLNGSAIVPDTSIVYDEGEGLRQLFDN
VLVQEDDVGDLITQAVLEITNPQNGNLESMALLSFVGASVQLGPASLTLTKPDGVAAWIQ
ILETVAYTNDAKAPRGEVQRVITVRIKDLAGAWSNTASCFVTIIERNDSPVLTSTAFALA
DEFEDETDTTATPLAALIGPSITDADADTLAGIAVTGFDTDGGRWQLLVNNTLWVDIPVV
SPASALLLPLDDAVIRFVPLPDFNGVQTLSFRAWDQTEGEAYNYTDTTAAAASAFNAFSA
SVGTLSINVLPLNDRPLLNATRVAAFPDINEDVPVADNTGASLASLVVGAIDDIDAGAVP
GVAVVEADVSNGAWQFSLDGGSSWTTANVSSAQYLLLDASSAQTRLRFLPNLQFHGTTSL
TVQAWDQTDGEASGSYVNSTRADAPTSPFSLAHARLLLTVLPVNDQPVLNATAATAVSLT
PIMEDVPSAANTGDAVSSLLERVVVDFDADAVLGAVVTAVDDTNGIWEYRGMYASAWRAM
TPPSGSGLPLLLKGTARVRFRPGLNFHGNATFTFHAWDQSSNSTNVTSALGDMTAAISDA
SAMAAITVLPVNDAPTFTGVPLRLNSIFEDVPARNNLGTTIADIVDAGVMDVDEDTELGL
AVVDSRVEGGSWEYQVVPGGNWSTFFGTILINGARYPEYATERRAFSLNTTQVSIDVESV
NDITQLQLNATGNATNAFVTFVEGSDGTLVTEGVTLTDEDDTHLAWVELLLADIEDGTDE
TLTVHMVNSTANVTLTAVRMGINNDMLRLTLSGSGLSLDMAALLLESTTYSNAALEPVVG
ERVLTVSVSDGLNPVSAQTRINVVPINDNAPLISNVTTDLVYDENSGFVHVSPWLQLSDD
DHNDLFFMDKALLELEDPRTTEVLRVDAQSAAASLPGLQASFANGVLTLNGPLSVNDMQA
VLREVEYADEAEEPDPDARRIHLTVLDDDFISNEVVFELEMALINDQTPVVDLSGDAAAG
IDYDNVTFVEEGADVSVVDAQRLTVRDDDSGPFLMQWASATIVNGQDGSAEQLYVTATSP
NITSVVYTPANYTLELRGAAEASEYERVLRTLMYGNSADEPQPPTERNISVVVADDSHVS
AAAVSRVRIELTNDAPVIDLSGPSVPGRDVVAQYREGQGALSLVDSSAARISDDDDTELA
YVSVSIVPRPDAEAEVLAFDAGVLSGAGSGITVNATSAGVVLRGPASVGAFEAVLRTLTY
ENTMAKPGRPSTALRHVEVVAEDVRGGVSLQSTAFVSFMGVNDAPILDLDASSPGSGYEA
VFVEEQGAVAAVSPTDLVLIDVDNATVSGAWARLWSAESASNADAQELVTDTSGTGLSWS
YDSASRVLSVSGVGTTAEYATVLSRVQYNNMEDEPHPANRTVTFTVSDGLATSTPVNSTI
RILLTNDPPRLAASSNLRNVFEDAALAVFPDLVLEDDDSDSLSSAVFRILNPVDGVLERV
YLPADVAVPSGLELRDNDTNSMSVVGTAPLSTWQDVLSSVHYRSLSQQPYPAIREVTLQA
RDDMNATSNTVRANIGVSTQNDAPRHRSSYPYDETVSVLEDGVLVLPSLRYFHDPDDVLQ
PSGVVVTPSPHHGTAQVNMTNGDVVYTPDANYFGSDSFGFLVCDSKQACSPATIDVAVQP
VNDRPTAENLTVTGPEDTLFVIDLLSLVDDVEDAAELWRGLSIVSEPGRGRLVGWLAGDG
TSTTTSTAASTLSSTTMDGSGMDATMPPMSGDGGSGDTTTTATTTTTSTSTTATTTTTMT
TSSSSWSLDMGSGDTSSSSSSTTTTATTTTTGSGMSPPVFSTTTTTTTTAPGSTTAFAGS
VTPAPPTEPTLPDTLFEPTLGLVGYIPDAHYHGEDAFRFEVCDPEGLCSQAVISLVIESV
NDVPVAVSIALTTEEDMAVAVDVGPYVADVEDADTSLALTVTQPTSGTGIAAGNTITYQP
NAQFTGQDAFTYTVCDRDGACATANVSVFVHAINDRPRAANITGELLEDSSLTLNLVDLV
FDVEDQLDGMDVTITEDVQSGALTYDANSGIALYVPDENFNGWDGFTYRVCDTQGLCRVG
RVDLTVWAMNDVPVTSTATLTVREDEAHALALRPYVSDVEDNAADLQFTVAVAPLHGTAS
IDASTAVLTYTPASDYSGLDTVRYRVCDTEGACARGEVDITVTEVNDAPVASDVATTTPE
DTPLLLLARDYVVDVDDDVADLSVTVGAPTTEHGTLRVDTRTGIISYTPDDNFHGTDAFN
FTVCDLAGLCDTASVSVEVLSVNDAPTVADVQENVLAGTAIVLDVVSLAEDVDEEPPSDP
NHVLNPLSVRVTRQPENNLAFVEVVDGRAVVTYVAQETTSTYGFFGTETFEFEVCDKFQE
CARGTATITVDFEGPAVASVVASDPDDGDFTFSTGDEIVVTFSEATNMPFGTSLDEEDVA
QLLELPTALAFSGRFTGAWASPTELVLTVAQCLTCRGEETGLQFDTTPPAVSLIFMDQFA
GERIRVRAEGGLRNAAETSLPSTAVAPRFTGDWGRAQPQVTTIEVSSPTDVSPSEAGFAL
PTGTQLVLSFNGPVNRLACTELTAEDFDLVFLQQVLSRGDDDALTADLGSVVGRWVVAGS
DECPLTEDEAMQLGANGGAVTARRRRAANVPTYADSLMLYVVDASTQTLPSVSDLTLFLS
VDDTSLGTEFNNYLQSSSQTTRKVIDVMDPNFDPVTDASTTNEGVYVVTFVAADPDNRDS
EFSVGDTLTLTFNTAVVSRDVSTKRAIDEALVFEQEGVAVDIADYEGEFTAPDTLVITVL
NATSNIVPAVGGMRVRMLPETFVAANDESVVNVQSGRLLEGDFGSPRETSAMYYVAPVLL
FVIAGLFALFALFKQKRAEDKRKMSAAVLTSGQEQTWMQPPPAVTMRKTQDPFTNFDTLG
ASQHGSAAAAAASSTKPQEKRVSVPRLSFDANAHRSLPQPPSQQQFSPRRRPSLIARSGS
TSSQQQQQQQQQSNPLSPVAVPPLRRDSAGEGAVPRRSNMPKGSLPPLRTQDPFRAASGA
PHFLPPLAKRPGAGTTRPPSLSRPPPPAAGRLASLSRAPGQGGAKRPSLAAPPRPSLPSL
RRGPPTMRPPPGTRGDSKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]