dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_09047T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_09047 | Salpingoeca rosetta conserved hypothetical protein (984 aa)
Sequence length 983
Sequence
MAIGTVTATLAFTDPEGTPVSVVAGSQDSAFVAVDGASIVFAAPINSNASDDVDDSPATR
AGIAISDRGVARTRTRQCDRGVARTPVSVAVLLLWLLLLLLWLLLLLWLWLSLLLLLSLL
HAALHCTPHCTARRTALHAALHTDTHKHHCTRESMSTYRLLSDSATDTPSVTDPLDVIPI
VLLTIVLFATVICTEAAAASPSQTTVAPKAVASRIGWAFESKRASGSNNDARNHRQFKVA
DRRLFTAQLLRVYEAEDGCASAPCVHGTCIDTPAAYACNCTGTGFFGPQCQHLITCNVTQ
DTTPQFSAQLFPEAPDNSIADDERAVFQRLSGFRSSASEDGPALVFRTCTASGRLACSAA
TTAHARTLSSQLFPDTIDTETALDVVDVLVVAQDRDLSTLPIDNITIGNLLITETSCHPV
QHSRAAAAGGTTPPPTSTPLSFPVATCESSSPCVRGTCTTRAGFIVCFAANETSAYTSTQ
LRQATLTALSSIPNTAGVWQTTGVTSTTDERCVHVLASEQVPGNSSVLAEVEYRVATSIF
TIVHPASATAPQATARRDPLTYDVTTALPAGTRIKAFGCACPTGFEGDTCADNIDDCSPN
PCWPGTCTDLVADFTCSCEGTGFQGDLTLTTLLPPDSTPAYMTSFTRTCRADQTYTNTEL
ACRDVNECDPDAQHQPRTYQQQALYTCDDGYTTTGDAQATATYTATCTATGNYTFQGTCV
EVDECAAQPCMNGGVCTDLVNAFECACVGEWGGPTCSDDTNRPPERISLSTTRVPENTFP
LPLVTVTVEDPDTHQSHTLQVLSSTPRACQRTPSRWTNGGSCSGGSGGAGAASPTLEITR
ALDFEVDGSAIEAVVRATDNGTISHLSADFLVRINVEDNNDAPTAVLLDTTSIAESMPAG
TLVSRISTVDQDAGDIFTYALVSPQGSTAAAAFQIMGDMLLVKSAAPLNHEANPVVTTSA
LLLWRVLAARAQGTAVAAAATCR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]