dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_11196T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_11196 | Salpingoeca rosetta predicted protein (1441 aa)
Sequence length 1440
Sequence
MQIATLARVAILLAVATATTSTYALLPGEWYPDGSTEAQVSGTAVDYIDLGTAQYNALID
FEEFYLNSTGTSSPVTFASSTFRLMTEYLAEKLTALALDTPDTIVIVQGFAPRPTNPTRP
PELTDIGRGLHMRYLNNGSLTNFLSDLANRSIEAGFDFVAIPGQGSYVNVSVPNVNCGRS
AVDLLFILDGSGSIGSSNFETMRQFTATVTSFFDVSPDTTRVALMVYSSSVTEIFDFSYV
LSNTRDEIITTIRNTNYPGGGTRTGSALDYARTNMFLTSRGARPSSAGVPRVAIVIIDGQ
SGDSVAQPAENLRNENVNIFAIGISGADVNELNMIASPPITNNVKFIDTFQAFSQLPAEI
SRANCEQPAVVSATDEIQINDTQPGEIRFFRPNPVNLFDNETDVFVSVTSPNPGPFNFDY
VIMNDEPLKTLNVRKTSSQVVSIAVRSRLTLLGRRRAEDTISYRLRVFNDLFNGPASHTI
MVTPARNQRGAPIFDAPEAINFPGYSFTYTLTGPGSSMFDIDASTGRITLRDPLPDGTQH
VVTLTGTSGSIVGGLALMVTTGQPTAEAATAPFTDVSATAHGDLHILTTSDARVWAPCST
AADMGAPAVAPFPTLFVGEVDLLHALRNMSNVARSINTWAMQEETRLFPAADEDTLLQLQ
DASKAATTWAAASLMPACTPRSNDAATLPDHAGWLETADDGTLHVVTQGSLRLHIPRTGT
LRVGDFDVVAALVNASNTLDRLRFGITDTLPSSFTESFPAEATAIGLPLSNTHDGTDPPA
FASTDSLPFTGIAVDDNSGELHMYSERDVCFLHTAHDGSAETDAGDGGAPRVLVGGVDIA
VAVMNVTALINTIATPLQALLDEAKLTLDCSDPASRNPIPTSGVSQVGSVVNCCCPELTS
LRRVLGDVHIATAATSADVGALQDVLGSIVLSGGQLASMDFGALRTIGGHVRITGAPLTS
INLGSIVSIGGDLDLRDNTALTSVSFGDITSIGGTVLLPRDTPGIGTVDFSHVRVIHGDV
DLTRTDTTQVLFGSLTHVGGTITIAYNAITNVDFSDVSHVGGDVVLIGDNSLESVFFNAL
TRVDGSLIVQGCTALSQINTWELHHIGGDLRLSNNVMLLSVSTAALRTIGGDYDVRHTAV
SAVTLTQLTRLGGMLWVDHDLFTTINHAELAAAGGGLGVCCGGPNVDTLNLFPFLFPYGI
GVDSMAGLRSLSIDSRTVVNGSLVITNNAALTAVSFHNAITAINGHVEITSNPMLASLQL
TSVAHIRGDVTVTRNAIMSTIAFPLLTAHNHSLILEYNDLAAVDIGELTYLGGSLSLYRN
NLGSFALTDLQYIGGDLSMAYSTLTTVSFGALTSVGGYLHVGYNPLQRLNFANITRIGGY
VAAQGAALSAVDFGALTSVGGILNFRANVGLTSVDCHSVTAECIAFSTAASLFNCPKPCD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]