dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_11387T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_11387 | Salpingoeca rosetta thermal hysteresis protein isoform YL-4 (1247 aa)
Sequence length 1246
Sequence
MFHWYGGCDDFCDDDCNAGCDYGCDYYCDSGCDSSCSTSCSSCDDSCDSNCTIFSIGCES
SCDSSCDYCVTTCDDSCDDYCDGGCDDGCDTCYSGCDSGCDICYDSCDDYCNGNCDYGCD
DTCAWTYCDDYCDDGCDTGCDGPCDSGCDDSCDDSCDTCTPISCDTGCDSSCYCNPGYYG
TAPYCSYCGTGTYMPYYGATNCYACDNCSPGEYRSGCGGSSAGTCRACASCPAGTYRYKC
GGQNSGYCRTCSSGCTRLTVCTSSQYEVRSQTATTDRVCRGLTTCGAGEQEKVAPTASSD
RVCEACPAGTTDANSDGSDACVTCGGGTYVPAGSTGTCSQYECSAGTADTDSNAGTACET
CDGATTYQPSKGQERCLSVKTCGAGEEETTSPSATRNRVCQPCQLGSTFKAQSGQSTRCI
SVTTCGAGEEEIASPTLSTDRQCRTCASGTFKAAAGQGTTCVAVSTCAAGFTEDVAPTPS
SDRVCVECAPGTFKATAGDGTCRAHRTCEDTEYETVAPTSSSDRKCKALTVCQDDEWESK
APTITTDRECSPCGRCTDGLTLDKACTDTSPTKCVGCDECASDEYTLSSCTLSSQTQCRQ
CTTCGSDEYQTKACSVSQDTECATLTTCSSTQFEVEAPTATRDRRCKDLTACQPGEYECT
AATLTTDRECCGVTQCVPGSEETSAPTATSDRECRQCVAGTTDADGSGTTPCVACSAGHY
VPRGRTGGCAAFECAAGHVDQDEDAATACKLCEAGVNYAGSAGLTRCTSVSECGAGEEET
SAPTASTDRVCSTCASGKFKATTGQTPCQPVSTCEEDEYVYRAATVSTDTQCRALTACSD
EQYETRAPTVNSDRECTGLTTCGSGEYETRAPTATTDRKCASVTQCDSTQFVVSKPTATT
DRDCAECDRCDSGTQYETATCTATTNRVCADLTVCADTEYESVAATDSSDRKCSSCRECT
SSEYLMSGCSESANAVCKACTECPSGTFVSTACTPLADAECTECTRCGSGYFVQSPCTSE
ADTTCKRCRSCASGEYLHTACTSSADAVCRKVSTCDVDAGYEVKAPTATTDRECRALTTC
DGESEFESRAPTLTSDRVCSKLTTCDGESEFESRAPTLTSDRMCSKLTTCTSSQYEKTAA
TATSDRVCSKLTTCTSSQYEKTAATATSDRVCSKLTTCTSSQYEKTAATSTSDRMCSKLT
TCTSSQYEKTAATSTSDRVCCRHCASVEQLYNCTADHPGICTCAPG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]