dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PTSG_11472T0 (Proterospongia sp. ATCC 50818 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | PTSG_11472 | Salpingoeca rosetta predicted protein (273 aa)
Sequence length 272
Sequence
MEYQPLPDRASCFPTSVCEEPFIETIPPTLTTDRLCSCDTLTCNKLVTQLFEEMMDAYAA
RRSCPGCTDTCECSAGFILVYDADSADCRPCDGVTEFSPSVGGSKYEPIEECERGQEEVA
APTRCSSDRVCHDCPAGTIDSDSDGSNHPLHGGELRQLLLQVQAMTLLISDRVCDECTEG
THKAVSGQGVPCLPIITTYDAGEEETAESTPTSDRVRSLCELDATFKSVDGQAESCRPVT
QCGPDEEEIRYANPHASTTASAASASRTRACP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]