dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSPMAP00000002947 (Petromyzon marinus 69_7.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:putative scaffold:Pmarinus_7.0:GL479712:1447:14741:1 gene:ENSPMAG00000002706 transcript:ENSPMAT00000002961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 462
Sequence
LTEKSPRSAPRPATQNSAPRPATQTTMARVSLGGEDTARFALLAALILCYLLCGAAVFSA
LERPSELVAQERWLHRLENFTQHFGVPRADLDALLRDFELGATAGVRAAPLRPRWDFTGA
FYFVGTVVSTIGFGMTTPTTVSGKIFLIFYGLFGCAAGILFFNLFLERLITLLACVMRSC
HRRQINRLVIQPGRKASDQSDAIECLAGWKPSVYHVMMILGIAAVAIACSASAMFSAVEG
WSYVDSLYFCFVAFSTIGFGDLVTGQRDLYDHQTWYRVGNIVFILAGVCCIYSLFNVLSI
VIKQTLTWMLHKADCRSLCRRRPRLRARNQRRNAVMPGVPRGRRNNNNNDAAGGGGGGGG
VETVAAPGPRRYDGGAGNDSDTDGRRLSGELISMKDFLASNKVSLALMQKQLSEAANGHH
HRVAHRCSPVHSHSLGRENGFAAGVGALAIMNNRLAETSEDR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]