dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PITA_000052746-RA (Pinus taeda)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein AED:0.47 eAED:0.47 QI:0|0|0|1|1|1|2|0|80
Sequence length 80
Sequence
MVLNVFFVSVLKIVDPKTGDEKQVTIYVDDVLHHNASLYDLEKLRCTFKKGEAPLLSSSQ
ASDGVGIVLLMKRVVAVQKG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]