dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSPSIP00000009912 (Pelodiscus sinensis 76_1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection scaffold:PelSin_1.0:JH211347.1:4054683:4259239:1 gene:ENSPSIG00000008947 transcript:ENSPSIT00000009962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 561
Sequence
MQRGECYIRANSIRVAVDKKRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEF
TKSVVKQMRAQPPFTMCFRVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAA
LLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELN
FLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRIHFIKWNEVTKMKFEGK
TFYLYVSQKEEKKIVLTYFAPTPEACKHLWKCGIENQAFYKLRESTSVSSARHSHQELGG
TKGAWGAELGREGPEGAGGVRPLPPQGHQNGHAGSDQWPVSYHAWSQSPGAPMWRRTRGH
VVLKEESLESLRDSAHSTPVRSASHSDAFLPPVRSSRVDSSERVAIISDEIYSPADSVLP
TPVAEHSLELMLLSRQINGAPCSIEEEKESEANTPTATEADEMRGEFKALCQGVGGTGGT
QATQVNKFVLSVLRLLLVTVGLLFVLLLLLIILTESDLDVAFFRDIRQTPEFEQFHYQYF
CPLRRWFACKVRSVLSLLIDT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]