dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|410471693|ref|YP_006894974.1| (Bordetella parapertussis Bpp5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence length 236
Sequence
MSSTKRPASRADEITQELVRMIQLADARRIAKLPTEMELAAQLGISRPVIRESLSRLESL
NMVTRRQGSGLYIVAPEKRSPEALVLLEQSAPLSPRSIAEAMSVRAILELETGRLAALNH
RQVDLDRMAAEIERLAATGARGLEAAEADEAFHRALSDAAGNVTLSQVLDLFLRLSWRRR
VEYFSQPKLGKQSIIEHQEILNAVASGDPDAVSTAIRTHLNSAERFWDSKYVKKKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]