dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|479185710|ref|YP_007816056.1| (Alistipes shahii WAL 8301)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Membrane proteins related to metalloendopeptidases [Alistipes shahii WAL 8301]
Sequence length 399
Sequence
MKKYIFTLIALSMVFTATARKPKNTRTTEAAAREIAAADSLRLVASRQAALIDSLQNLVA
VAEQRDETAESETAAPDPVVDPEQAAADSVAALRLRLRPTKIESIFDTNGLTVLDTLATE
NDAVQVILYSNNSWKYVLNREVAKDSTIFEKYWDTTTLFPYKEVDMSEMPKSVVIDLVDS
LTSYHCPYQGSVHPRGKYGPRRRRQHQGVDLPLKTGDPVYATFCGRVRISQYNRGGYGNL
VIIRHDNGLETYYGHLSERLVEPDQWVEAGQIIGLGGSTGRSTGPHLHFETRYYGQSFDP
ERLIDFKNGTLSRETFLLKKSFFSIYSNAGQDFEDEIANEEQDKKEAAEKAAMKYYKIRS
GDTLGGIARRYGTTVTNICRLNGIKSTTVLRIGRSLRVR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]