dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|357389455|ref|YP_004904294.1| (Kitasatospora setae KM-6054)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein KSE_25250 [Kitasatospora setae KM-6054]
Sequence length 313
Sequence
MRDPKELYELEPQGVTALAAARAAAEAGTGLVLLYHFEGFMDAGEAGGQVVAHLLEQGTP
QVVARFDHDRLVDYRARRPAMTFDRESWTDYDPPEILLQLARDAVGAPFLVLTGPEPDTE
WELFAAAIADLVERFEIRLALSFHGIPMGVPHTRPVGLTPHGNRIDLAPGHPKWFDQAQV
PGSAQALVEFRLLEAGHDVLGFAAHVPHYIARSSYPAAAVAILEAAQSATGLVLPGSELR
ARVNEVYAEIEDQLSQGDGELRAAIQGMEGQYDAVSGVVDRESLLAEANDLPSADELGRR
FEEFLAEHERGAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]