dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

SSCA009832-PA (Sarcoptes scabiei)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep supercontig:SscaA1:JXLN01010401:18479:21619:1 gene:SSCA009832 transcript:SSCA009832-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 964
Sequence
MPSSHSSSSILYLLTVDSYIIFANRKDIRKLDENVFSSSLTGHRKAPNATVLIDQLEDAT
AIDFDYEKNLLFWTDLGFETIKGFGLDDGHIFDVITTGIESPESLACDWITKKLYWVDSE
TNHIDVSNYDGSHRTVLFWKDLDQPRTIVLVPSDGIMFWSDWGETPKIEKASMDGNHSTR
EIIIKNNISWPNGLTVDYVTKTLYFADAKLGYISSCDFEGRNFKTVVSNVSQIFALTLTG
NILYWTEMQNTNSIKNHHSFKNGIHFYDRSLDKLGVPYINPHQSLSPLGITVFDVNRQPK
SYNPCAHNNGGCSHLCLLSSNSEHYSCACPTGIKLELDGKTCHSSAQKLLLLARRLDIRR
ISLDTNDYTPVVLPIKNIKHAVTLDYDPIEGKVYWTDDELLVIKRASLNGSQLETIISTE
LMYPDGLAIDWIARNIYWTDAALNRIEAARLNGTSRKIIISKDIDQPRAIVVHPLDGIMF
WSDWGVPGKIERASLDGSDRIVIVNTSLAWPNGLAIDYELSHIYWCDAKTKAIEMSRFDG
SNRRTIAVIERSHMYDLTLMDEFIYWTDWTRRTVEKTYKLTGSEISIVIENLPDLMGLKA
VSISSPNGTNPCGDNNGNCSHLCFNRPHQRYVCGCPDGSSQLEEDGRTCTKSDSYLIFLD
KIEMNRVSLKTKKIDHLPIIDIKSASAIDIDIENEIIYWADPKNHLIARSHFDGSKFEII
LQNDLGTPQDISFDWISENLYWINSEEKRIEVSRSNGIYRKIIFQDRHSQLNSLVVNPVD
GYLFWSDRSNAGKIIISFLDGNRRKILVDSVGSAISLTIDYGEKILYWISMEYNIIMSSY
FNGNSRTALNFENSMKPISIAINDEFIYVLNQNSDLLEYFSKKNHSIKSILDQNDLYASA
NQMILFDRSNQKGWNFCADQNGGCEQLCFVKPVQKNNVHESYCGCTTHYFLDGHESKKCS
RKFS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]