dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YLR425W (Saccharomyces cerevisiae CLIB215)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment TUS1 ORF Verified Guanine nucleotide exchange factor (GEF) that functions to modulate Rho1p activity as part of the cell integrity signaling pathway; multicopy suppressor of tor2 mutation and ypk1 ypk2 double mutation; potential Cdc28p substrate
Sequence length 1307
Sequence
MYRYNRSSPFERTPEKRVSRQESQRKSIELPKLPPLNTRNSFLDDSDNGTDNISIGWTPI
SDTQQFQSPVPQAFTFTSKHSARGNGTSSSESTPKSTKYVKERRPPPPPPLLYSTESIRI
DSPMVSPSSQSRERSPNKLSFIGNSEERHHMEYISNHSRILKSPFANGFSPNSPKSPRDS
SKQQAHFSDESDLRCHEREKALPPIPFTTTLLLSPFDDEDSEFFTKPPPPLSTSRNVSGN
SRVSEALESVYSDSDYTFNNSNARQSSFNSLLGAKPLELAPSITAPTQPFSIQSIDEHKL
YQCDNVYKLSAIYEWILKVYFEWFNECVFTKIDLFQIVQLLLEFQMPTNFDQDTIDSNVD
NIMASFISQKAVRFDIINDEEVAVVVGGLDITGVFTELLPCYSFIDNTYGSTNSLICYSN
VCTHGQSSGFRKEIKLSEIINKSVGLWTEYWHLTPDDLAEINPREVQRQSFIFDLIILEE
RSLNMATAAVEIYGKRFDKSLLPDEPEFKALAFDIFEPLIQLHTEFLLTPIFWKLKTRGK
FIDGVGKIYSKWCGEAKNIYLNYAKAMATVHEIIMWEKKNKTKFVTWLKEIDNSVEITRS
KMYHDVIFFGGFFKSLQNMPVTLRSILKNTDPSMEDYEYLKIVIKEVEKLNFEVNQVHGL
AIDHRKLVRFSKQLVLSTNSSNATSYVNVGGSTNANDDDAIQDKLALGLTYPERKLVLSG
TVYKKRDLWLDPTPVYIALLDNCLLITEEISKGETQKYKLIERPIPIDYLSLEKRKIPGT
SKQPLRNYSQKEHKSPMHNFSTPINSMRPLLKSSGNHMSTAYGDRKTSNTEISNANPNTD
EFSFKIRNTATGESFKFFTESAEVLNQWIDAIMESFKRNAENHDLNAFEFTVLSSEFAYF
DKDAPVNLPVAPEGSEIDVALKAYAQKANKDSCSWSKTTRILCCEDVKFEGRIYLFVATT
DGIYVKYRDDYGSGFVKILELNDVKRMEANVKLGLLFVLDNRKLCYFNISTVVSRYLAQG
NTLDENCIVGTVIRDKVRFFKIADDFGNSKHLFFERKGKIVILTPEFDQLTNQVKYFKFY
KEYKLPSSSNNILNNEIEDIAIFRKSFAVCTKKTVILYQDSFEDNGIVLPSFLNDKDMMA
HLRHPHLNSLPFKSATDSKKRPSIESLTEEAKKDIATCKAIPVNFFQISQSRFFALVYDE
AVVKINCYGEMSDWRKDILLLDFCCTGASFHGNHLILVGDNLIQIYDLKNVEQNLGELVP
VQIIKGKKIKLASSERREKTILVLSHPNILNRQLLVACNPVAMADHQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]