dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ABFF01000014|CDS_59015-57867 (The Salmonella enterica Pan-genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment /sourcefile="Salmonella_annika.proteins.fsa.dir/20591.proteins.fsa" /gene_family="280" /family_size="24" /organism="S. enterica Weltevreden str. HI_N05-537"
Sequence length 382
Sequence
MKNFKKMMTLMALCLSVAITTSGYATTLPDIPEPLKNGTGAIDNNGVIYVGLGTAGTSWY
KIDLKKQHKDWERIKSFPGGAREQSVSVFLNDELYVFGGVGKKNSESPLQVYSDVYKYSP
VKNTWQKVDTISPVGLTGHTGVKLNETMVLITGGVNEHIFDKYFIDIAAAAADESEKNKV
IYNYFNKPAKDYFFNKIVFIYNAKENTWKNAGELPDAGTAGSSSVMENNFLMLINGELKP
GLRTDVIYRAMWDNDKLTWLKNSQLPPSPGEQQQEGLAGAFSGYSHGVLLVGGGANFPGA
KQNYTNGKFYSHEGINKKWRDEVYGLVNGHWQYMGKMKQPLGYGVSVSYGDEVFLIGGEN
AKGKPVSSVTSFTMRDGNLLIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]