dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YKR096W (Saccharomyces cerevisiae LalvinQA23)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ORF Verified Protein of unknown function that may interact with ribosomes, based on co-purification experiments; green fluorescent protein (GFP)-fusion protein localizes to the nucleus and cytoplasm; predicted to contain a PINc domain
Sequence length 649
Sequence
MQTVVTFLTQKICLFRILIFSSISSGMAPLLHNRIFYKLLDLESQKNPFAILFELPKYLK
ERKDKKERKKSSNNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLR
RPILPSMLTNEAWLETLKFLNMTSLKCGIIVLQKFLHGPLGIALPHILPWIYFIISICLK
SSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDEYDKLSLS
ELLELFNEGEELPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGII
FDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLE
PLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYT
CFDKNGEFLSASLYTTWYVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEIDFKTTY
FVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQ
LYYENKVLPLRFTGNVATHIEENXEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLS
PRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]