dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YGR083C (Saccharomyces cerevisiae T7)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GCD2 ORF Verified Delta subunit of the translation initiation factor eIF2B, the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression
Sequence length 651
Sequence
MSESEAKSRSATPPSKAKQATPTTTAAANGEKKLTNKELKELKKQEKAAKRAAMKQANGI
SIEQQQQQAQMKKEKKQLQREQQQKREQKQKNANKKKQNERNVKKSTLFGHLETTEERRA
TILALTSAVSSPKTSRITAAGLMVPVVASALSGSNVLTASSLMPVGPNASSTVSASAPAS
TTTTLPASSAALSAGTSSASTNTPTAIQQEIASSNASDVAKTLASISLEAGEFNVIPGIS
SVIPTVLEQSFDNSSLVSSVKELLLNKDLIHPSILLLTSHLAHYKIVGSIPRCIAMLEVF
QIVIKDYQTPKGTTLSRNLTSYLSHQIDLLKKARPLSVTMGNAIRWLKQEISLIDPSTPD
KAAKKDLCEKIGQFAKEKIELADQLIIDNASTQIEESTTIVTYGSSKVLTELLLHNAISL
KKNIKVIVVDSRPLFEGRKMAETLRNAGVNVMYALITSLDTIFNMDVDYVFLGAHSILSN
GFLYSRAGTAMLAMSAKRRNIPVLVCCESLKFSQRVQLDSVTFNELADPNDLVNIDYENP
VERRGNKGALLNQFIKERKFEKKKLAMENKPKGNKIGGKKGSEGESKDASNEEDSNSKNI
LDGWQELPSLNIVNILYDLTPPEYIKKVITEFGALPPSSVPVILREYKGSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]