dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YDR244W (Saccharomyces cerevisiae UC5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PEX5 ORF Verified Peroxisomal membrane signal receptor for the C-terminal tripeptide signal sequence (PTS1) of peroxisomal matrix proteins, required for peroxisomal matrix protein import; also proposed to have PTS1-receptor independent functions
Sequence length 612
Sequence
MDVGSCSVGNNPLAQLHKHTQQNKSLQFNQKNNGRLNESPLQGTNKPGISEAFISNVNAI
SQENMANMQRFINGEPLIDDKRRMEIGPSSGRLPPFSNVHSLQTSANPTQIKGVNDISHW
SQEFQGSNSIQNRNTDTGNSEKAWQRGSTTASSRFQYPNTMMNNYAYASMNSLSGSRLQS
PAFMNQQQSGRSKEGVNEQEQQPWTDQFEKLEKEVSENLDINDEIEKEENVSEVEQNKPE
TVEKEEGVYGDQYQSDFQEVWDSIHKDAEEVLPSELVNDDLNLGEDYLKYLGGRVNGNIE
YAFQSNNEYFNNPNAYKIGCLLMENGAKLSEAALAFEAAVKEKPDHVDAWLRLGLVQTQN
EKELNGISALEECLKLDPKNLEAMKTLAISYINEGYDMSAFTMLDKWAETKYPEIWSRIK
QQDDKFQKEKGFTHIDMNAHITKQFLQLANNLSTIDPEIQLCLGLLFYTKDDFDKTIDCF
ESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNIGC
FKEAAGYLLSVLSMHEVNTNNKKGDVGSLLNTYNDTVIETLKRVFIAMNRDDLLQEVKPG
MDLKRFKGEFSF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]