dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YHR117W (Saccharomyces cerevisiae UC5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment TOM71 ORF Verified Mitochondrial outer membrane protein with similarity to Tom70p; probable minor component of the TOM (translocase of outer membrane) complex responsible for recognition and import of mitochondrially directed proteins
Sequence length 639
Sequence
MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG
QNEDEADLKDDGSVVNGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP
SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV
IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD
ALQRLYSATDEGYLVANDLLTKSTDMYHALLSANTVDDPLRENAALAFCYTGIFHFLKNN
LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAIDLNPEYPPTYYHRGQ
MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP
EVPTFFAEILTDKGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK
LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]