dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YIL073C (Saccharomyces cerevisiae UC5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment SPO22 ORF Verified Meiosis-specific protein essential for chromosome synapsis, involved in completion of nuclear divisions during meiosis; induced early in meiosis
Sequence length 975
Sequence
MSDHNVNSTFRKTLVELCETATWITSQVYAAKNLEKNDLITVDNKISALYPIAEKYDRSF
RTTTVILDEELILKLENAASSLWNSLTIAMKAEKASDKYFNEVFCKCKIFATKLLSIHEA
LFRTNTNLLRNFKCYISSFKSASEYRFDDLITNTQQHSEKYLQIINEHVESFSNEEKTEF
KKLTFEFYLVNFQLYLSENDLDTANIYTAKVNITDNSKYMDADLLIELCRMIYNSTVMLK
EINDPETQLVDVNIISFLKDVEKYLELPVENLKSHTDYSNLKYSVLIFMANCLVEGYPQA
SELEQCDHYLSLLQNEYPNKVDPFILAINLTKRRNIVNPAETIEEILMRMIMSVDVISNF
QAVIASINDLSKMDTKFSIVCLDYLLTNKLNSKNDSKFLEKAICSRFLITTQSKTMNDSE
IAESLENFSTQMERIVSEPLTKHAISCIITLLWNTGKKLEKMEKYVVSIRFYKLALKDII
SQNYSDRGKIQRALQVVYNKIEDYSNTVRVYQDMDEVDRQSPLCQLLMLQSFLADDKTEE
ALTCLQKIKSSEDEKSTDALILAVAECKRKTDLSVQGLLMIFDKLQSKSNSQTISSTSSS
QTLSILRYTLQMIVKVSEEEPLETFINYLPTVQKLLQKAVEFLKTVKLLNQLPPDVEKEA
IYQQSVAVNEIEWFASFSYNVAVKCLVDQSCESISEFPQYCIQFIDLIPVQDFTFPKMYH
FTYWKFKATILQLIIAKGKAKQDQHQKDWDIYEKSEELVNSINVMKKSSEFKDGSSLEDR
NTLHECFLEALTIHLESALIMPDQTRILDILKKTELYQDSRVDALLIDISSNMEDLPKGV
LIEILETVLKRNMGPEVKEQEICSWLRILLENAINLNHEVELRILDRVLKILNINQSSLQ
DTDGVLQTELETIATYCWNIGVNYIIKDNKSNGIVWCKHSMGFANMVNEGLQEQLYSLWE
SLASSANIDINSIAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]