dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YML046W (Saccharomyces cerevisiae UC5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PRP39 ORF Verified U1 snRNP protein involved in splicing, contains multiple tetriatricopeptide repeats
Sequence length 629
Sequence
MPDETNFTIEDIEPRPDALRGLDTQFLQDNTALVQAYRGLDWSDISSLTQMVDVIEQTVV
KYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPT
SLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNV
QRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIVLRKTQTTVNEIWQFESKIKQ
PFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWL
TKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLK
IWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSITNYINNQIDAKVH
LQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKS
NVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILY
PELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPI
SLPNFRNLEKINQVKINDLYTEEFLKEGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]