dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YDR104C (Saccharomyces cerevisiae VL3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment SPO71 ORF Verified Meiosis-specific protein of unknown function, required for spore wall formation during sporulation; dispensable for both nuclear divisions during meiosis
Sequence length 448
Sequence
MKAYRANPPLPIDSMIDDTSTEIEKEEIWKQWKKIPEVYEQQPYPLDTNDHIEWMNCQTT
QSEYDSRDFYAFHCFHRRIDQILKTDNVIDLTEVKDIYQGTRTDYEADKIKYGVYKEASE
IFWHRNYEIDDVSRSVINIETSNGLLLKLLATSATVAEEWVIKLKQMISYWKNKQREDTE
RLLKIRRSNAGLLMLNGEEETKIGENTLRWIVEHGRADEQTFNANGISLSRPLIQKGPLY
QKPHKHSVFSKYYVVLISGFIVLFHCFHRSTTGFAKEVLEYAHYVTIPIDDCYLYSGTTT
ELDLLQRDRTFDEINYGSHALPRVYGDGWRSVEDESSRCFTLWFGTRRALSSNRLQKKGN
EKQYTQDYGRQDNNIDPPSAPEADLNNSNVPSNTDKIHFTKKLGVSGKSMVFMARSRQER
DLWVMSIYYELERLRRTASTSNSRNQTM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]