dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YGR047C (Saccharomyces cerevisiae W303)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment TFC4 ORF Verified One of six subunits of the RNA polymerase III transcription initiation factor complex (TFIIIC); part of the TauA domain of TFIIIC that binds BoxA DNA promoter sites of tRNA and similar genes; has TPR motifs; human homolog is TFIIIC-102
Sequence length 1025
Sequence
MAAGKLKKEQQNQSAERESADTGKVNDEDEEHLYGNIDDYKHLIQDEEYDDEDVPHDLQL
SEDEYNSERDSSLLAEFSDYGEISEDDEEDFMNAIREASNFKVKKKKKNDKGKSYGRQRK
ERVLDPEVAQLLSQANEAFVRNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLND
CCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSMLY
KKTGQLARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSIELYMKVFNANVERREA
ILAALENALDSSDEESAAEGEDADEKEPLEQDEDRQMFPDINWKKIDAKYKCIPFDWSSL
NILAELFLKLAVSEVDGIKTIKKCARWIQRRESQTFWDHVPDDSEFDNRRFKNSTFDSLL
AAEKEKSYNIPIDIRVRLGLLRLNTDNLVEALNHFQCLYDETFSDVADLYFEAATALTRA
EKYKEAIDFFTPLLSLEEWRTTDVFKPLARCYKEIESYETAKEFYELAIKSEPDDLDIRV
SLAEVYYRLNDPETFKHMLVDVVEMRKHQVDETLHRISNEKSSNDTSDISSKPLLEDSKF
RTFRKKKRTPYDAERERIERERRITAKVVDKYEKMKKFELNSGLNEAKQASIWINTVSEL
VDIFSSVKNFFMKSRSRKFVGILRRTKKFNTELDFQIERLSKLAEGDSVFEGPLMEERVT
LTSATELRGLSYEQWFELFMELSLVIAKYQSVEDGLSVVETAQEVNVFFQDPERVKMMKF
VKLAIVLQMDDEEELAENLRGLLNQFQFNRKVLQVFMYSLCRGPSSLNILSSTIQQKFFL
RQLKAFDSCRYNTEVNGQASITNKEVYNPNKKSSPYLYYIYAVLLYSSRGFLSALQYLTR
LEEDIPDDPMVNLLMGLSHIHRAMQRLTAQRHFQIFHGLRYLYRYHKIRKSLYTDLEKQE
ADYNLGRAFHLIGLVSIAIEYYNRVLENYDDGKLKKHAAYNSIIIYQQSGNVELADHLME
KYLSI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]