dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427723359|ref|YP_007070636.1| (Leptolyngbya sp. PCC 7376)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence length 1322
Sequence
MTPVMEGNVFGATPFSEPLSLAGAHRGRKTTQKIWLFFMICWELVKRILIGSSVLFAVCG
ANGRAIADIAPDNSLGFESSVVTPNVLIRGSLADEISGGAIRGQNLFHSFTDFSIDPNQR
VYFANPSAIDQIFTRVTGSSSSDISGTLGVNGAADLYFINPNGIYFGDTAYLDIAGSLIA
TTTDSIPFVDGFAFSTDANPIPTNPLLTVSQPLGLTAWTTPQAEITNRSQLAVGNDLTFV
GQSLDLEGVLWSGGDLTLMAADNLQIRDRLDAPFITLSGGSQTLEAEIIDIFALSHPESG
LYSYGDLVLRSPNPIIIDSYFNSLGNFSLENTNGGAGDALSPNDPVIRSSGNVTFNAYSG
ASLHIFAGGSIQTGDITINAADSTNGLQEVVTLSDGSTTVNIDGQNIATLDIRAGTNAFD
SDSVVGLITPLPPFFNDPCVSGSANCFSSFPPVPPLSVLQGFSTTAPPSNADIIIGSLTF
TNGLVDNFAFISNQYEPNTNDLLRGDILLGMRLSGEPGEISLNTSGDISLVVDSRDDIIV
FGEIKPLTKGLEIGEILLKANGDLFVDNGLGSVDIDASSGKIVNDTRIGNASIDAKGTIF
LNNSIDSAGNVAINANALIAQGGNQIRTSTRDNNDAGTIFVKANQVELSGINSGGVFSGL
SSISADGSDGDAGKISVETDVLALDDGGQIRTSTFGAGAAGSIVVKANEAVTIDGGNGIF
SGIISEVGASSTGSAKLIDIQTKQLTFTNGGIISAATAGAGNAGQIKVVVDETATFDGNP
GFPLFPSGVFTESLASATGAGGSINFQAANLEITNGATIKSSTQSSNLAGDIDISVANDV
VLAGADTGIFADTSSFNVAGEGGKVTVTGRNLNMSDGGRISSSTTGESKAGDVAVNFSND
VAIAGADTGIFADTSSFNVAGEGGKVTVTGRNLNMSDGGRISSSTTGESKAGDVAVSFTN
DVAIAGADTGIFADTSSSNAANGSGGPIAVTSQNLTLTDGGRISSSTSGAANAGDIKVDV
SNDITVSGEGSGVFASTTETSTGDGGNVDIDPIFIRLSDAGRFSVSAQGSGVAGNMRVVG
DFLILDNGFIDASSQNGSGGNLTFEIGEYILLQNGSDITTNAGLSSGGGDGGNMMINVPF
VIANPNQDNNITANAFDGDGGNIEITTDALLGIAFNDEDISVRNDITVSSELGVDGEFIL
NSPDVDPSSGLAKLITDLGDRENRVVSACAAGDELNSFVVTGQGGLAADPSSFVRGSSLL
SDVRDFSGETVSTEVNEAVAVQPSEPMPTIRQATHLVRSEQGIELAATHPKALQNKVSSN
CL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]