dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427724591|ref|YP_007071868.1| (Leptolyngbya sp. PCC 7376)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribulose-5-phosphate 3-epimerase [Leptolyngbya sp. PCC 7376]
Sequence length 229
Sequence
MTDKKIAISPSILSADFSRLGEEIKAVDEAGADWIHVDVMDGRFVPNITIGPLIVEAIRP
YTKKPLDVHLMIVEPEKYVANFAKAGADIISVHAEHTASPHLHRTLCQIRELGKKSGVVL
NPSTPLDIIEHVLDVCDLILIMSVNPGFGGQSFIPSMVSKIEKLRAMCDERGLDPWIEVD
GGIKPNNAWQVIDAGANAIVAGSAVFKADDYADAIEGIRNSKKPEAVAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]