dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Tb927.8.7760 (Trypanosoma brucei TREU927 v4.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_08_v4:2252048-2254747(+) | length=899
Sequence length 899
Sequence
MGAAPSRETLRRGLYNVPTQMKNNVDSSRSQSKPDIVLIPLIKEYFPSADCPLFVQFHKM
RCDPGVNYYFRHPLYPGDLSRIPNVHSNDARSSNRSRDALYSEFVEQTEERLFDTDNEMR
QAHELSMSDRSAGGSPSFHMEGAKTANVGKKVLPIICAVAFLHDREKFEQLQQTQGTPGG
SRVPHVLMGKENSDILEGKVVNIIGFFGMLPREIERKPLTSPVIFSPVSPGLSATGKGIA
APSMLKNSLSLPCTARGPSHGSSQDLQQLIAPLSSQASVASGNELRNRPSFVPTPHVPPE
RCPLTASAGAFSLVSSLGGTPAREPSARQRPFLQSEGLLREMDQALSYRCTALEERLSRF
GLPAPAAPEPLTAVVFMTKSAGEQNLCRVTFVAAKTYHGQLVEAGVLKQRGNGPSPPLES
ERRYLPPLETFSFSSLMTNVPFISFVYEMRCRWGRFGFFSRRVDSPSLRMGSLNASSSFT
YGFTGGAHSEAPNPEETHRGFAMWLTKNGVFHGRIERELAEHLCFCMAEQPDFMSVPAAT
LPIGGGYWRFRGLVDRNNPRPIQLCGDGAEAADPLDVYVMGSPAVGGFDEGDVLKYDQTS
RSWVANRDIPLDAVVLAAMRPFCKAARTAPPDDIGWVTIEVEEQDEMGVEDQDHLETAGK
RDMDTGAVVRQEDRDGTVVRKRVHVREGNFYIYRFELNGEVHYHGTVPDFANPNKKRASH
SSSVGARSVAPMGPAVVARRFDNTNERGRQHSVGLTADRSTNEHSLSVTSTFSPPFVESF
MGSERTSATFLASPLQPVREAISRSVGTVSYSNRGYESTGSQSSFPVVPVTPDTMFPPSR
GLTTPVARRRSTFVPVGSEVEVDESQRDTNESDGGPTAFVRRFIDSTVYIWDWRYCADR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]