dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Tc01_g015370 (Theobroma cacao B97-61/B2 v1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment AP2/ERF and B3 domain-containing transcription factor At1g51120
Sequence length 361
Sequence
MDEDESSMVSNAKWKVAAAETSDCGNSNYPLRASKRSGHETNASLARFKGVVPQQNGHWG
AQIYANHQRIWLGTFKSEKEAAMSYDSAAIKLRSVDSHRNFPWAEHNIQEPNFQSLYSTE
DVLNMIRDGSYQAKFAEFVNILSERNGILGSKSVNKNLVHGDMHFSCVQLFQKELTPSDV
GKLNRLVIPKKYAVKYFPYICENDEENVAGVGVEEMELVFYDRLMRTWKFRYCYWRSSQS
FVFTRGWNRFVKEKKLKERDIITFHTCECPALVEKDALNFFLIDVNYNGEQRCINEDKVL
NGLESSPQDLQVELELNLGKSFYCRIDNCNSLFNEDKGLSGLKSSHDVEEKRVTLFGVQI
N

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]