dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AMSG_05227T0 (Thecamonas trahens ATCC 50062 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | AMSG_05227 | Thecamonas trahens ATCC 50062 hypothetical protein (573 aa)
Sequence length 572
Sequence
MAAAATSATAPAMNTNEEEDNSGEMMAVTLTLGPRGSDTHRAMFPASATANEVLATLDAV
AELDIDPQRVALLIPGAAEREAETAELSAEEMSMQKPRLLGSRSAPRWLAGEARLGSARL
GHEPRLSLRRRTRRVRILVTSFSKVLRYDVCAPVGELLAAFASRIALANPEEFGLTMVGL
GPHKWLDLTLPLHCQVWSPEVSESDDALIQLKFRRRLYASHLDLSACVLPVVSLEIADDV
RAGRYLVDTAKAVELTALHLAVYAPRELTALPSPLDEYLPAQVVEAVRSDELHARILARH
AELRQEEGRALAEAYVQAAAALPLFGATRIECGENGVTLSIGREHGLVVLDGMYGTSPPP
LATLDIAEWKAGERGRPTQSAIIDIVALEAIVGWRHTSRTVTLVLGSEPEREVTFGTARA
DEVVHQLERLTELLSAETGQRAWEQAEWTDGMHVSPMFASGEHEFQPELFEVDLLRPRGG
GAVIDGSWAPGAPTALELTLVLHALIGGAAALSAAGDGESVHRRMWLAWAAAAGAVRLLA
AVSPHEFGLFLALPPIRLFCLDGCSHLLEQSQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]