dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

tetur01g08860 (Tetranychus urticae )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment length:254 (n/a) (unnamed protein product)
Sequence length 253
Sequence
MKALRMFSFILIILIVPRDLYAATLSQYTANPAPSYQYTNGYGNYQIVCQPNQFRCSSGL
CIHESSRCNGKTECPSGDDEQLCPCQQSKRCIPWSQLCDGKIQCLLGDDENQTNCKLPIN
NETNVTEPPIYQPTTYDYSNQGNSSNGGPGATVVKVNKVVQSADRTTNEFHPKKDDSGFL
FVNFGPIINGDNNVNGNGNDLGNGNENGNGNGNGNGNGNGNENGSGNNNHYQKFIPSGED
YKNYYTEGKAYYP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]